PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G15700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 353aa    MW: 37133.7 Da    PI: 5.0195
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G15700.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.68.4e-16282333556
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                      +r+rr++kNRe+A rsR+RK+a++ eLe +v++L+++N++L+k+ ee+ ++ 
  OPUNC08G15700.1 282 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEQNMELQKKQEEIMEMQ 333
                      79********************************************999985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.8E-15276329No hitNo description
SMARTSM003381.2E-14278342IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.208280331IPR004827Basic-leucine zipper domain
PfamPF001703.7E-14282334IPR004827Basic-leucine zipper domain
CDDcd147074.07E-26282334No hitNo description
SuperFamilySSF579591.81E-11282332No hitNo description
PROSITE patternPS000360285300IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MDLKDGGGSE KRGAAALARQ GSIYSLTFDE FQNTLGGMGG GLGKDFGSMN MDELLRSIWT  60
AEESQAMASA SGAAAAGGGG AAAEGGLQRQ GSLTLPRTLS VKTVDEVWRD FEREASPGAA  120
TVDGGGGEQQ QPRRQPTLGE MTLEEFLVRA GVVRENPAAA AAMVAAAAAP PVAQRSIQAV  180
NNSSIFFGNY GGVNDAAAAG AMGFSPVGIG DPTMGNGLMS GVAGIVGGAI TVAPVDTSVG  240
HMDSAGKGDG DLSSPMAPVP YPFEGVIRGR RSGGNVEKVV ERRQRRMIKN RESAARSRAR  300
KQAYTMELEA EVQKLKEQNM ELQKKQEEIM EMQKNFFPEM QKNQQWNTEF SCC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0371170.0KT037117.1 Oryza sativa Indica Group cultivar Nonabokra abscisic acid inducible bZIP protein (TRAB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650926.11e-175PREDICTED: bZIP transcription factor TRAB1
SwissprotQ6ZDF31e-155TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLA0A0E0LVU90.0A0A0E0LVU9_ORYPU; Uncharacterized protein
STRINGORGLA08G0211300.11e-162(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.12e-36abscisic acid responsive elements-binding factor 2